SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000399228 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000399228
Domain Number 1 Region: 10-94
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000347
Family Protein kinases, catalytic subunit 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000399228   Gene: ENSG00000011566   Transcript: ENST00000414968
Sequence length 143
Comment pep:known chromosome:GRCh37:2:39520384:39553074:-1 gene:ENSG00000011566 transcript:ENST00000414968 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
FQPPKLKDKMKWSNSFHHFVKMALTKNPKKRPTAEKLLQHPFVTQHLTRSLAIELLDKVN
NPDHSTYHDFDDDDPEPLVAVPHRIHSTSRNVREEKTRSEITFGQVKFDPPLRKETEPHH
ELPDSDGFLDSSEEIYYTARSNL
Download sequence
Identical sequences H7C1A4
ENSP00000399228 ENSP00000399228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]