SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000399968 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000399968
Domain Number 1 Region: 1069-1114
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000353
Family Nuclear receptor coactivator interlocking domain 0.00052
Further Details:      
 
Domain Number 2 Region: 123-189
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000017
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.03
Further Details:      
 
Domain Number 3 Region: 268-372
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000306
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00055
Further Details:      
 
Domain Number 4 Region: 32-92
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000055
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000399968   Gene: ENSG00000140396   Transcript: ENST00000452400
Sequence length 1464
Comment pep:known chromosome:GRCh37:8:71021997:71316040:-1 gene:ENSG00000140396 transcript:ENST00000452400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELAELIFANFNDI
DNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML
EALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSI
VNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKYETMQCFAVSQPKSIKE
EGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV
RRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQT
TNEPQLVISLHMLHREQNVCVMNPDLTGQTMGKPLNPISSNSPAHQALCSGNPGQDMTLS
SNINFPINGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPG
QPTSMLSPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQAL
SEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQA
ESSCHPGEQKETNDPNLPPAVSSERADGQSRLHDSKGQTKLLQLLTTKSDQMEPSPLASS
LSDTNKDSTGSLPGSGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKDLSQESS
STAPGSEVTIKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTK
LIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAII
NDLMQLTAENSPVTPVGAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAG
PFPPIRNSSPYSVIPQPGMMGNQGMIGNQGNLGNSSTGMIGNSASRPTMPSGEWAPQSSA
VRVTCAATTSAMNRPVQGGMIRNPAASIPMRPSSQPGQRQTLQSQVMNIGPSELEMNMGG
PQYSQQQAPPNQTAPWPESILPIDQASFASQNRQPFGSSPDDLLCPHPAAESPSDEGALL
DQLYLALRNFDGLEEIDRALGIPELVSQSQAVDPEQFSSQDSNIMLEQKAPVFPQQYASQ
AQMAQGSYSPMQDPNFHTMGQRPSYATLRMQPRPGLRPTGLVQNQPNQLRLQLQHRLQAQ
QNRQPLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQ
RTLMMRGQGLNMTPSMVAPSGMPATMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATT
PQSPLMSPRMAHTQSPMMQQSQANPAYQAPSDINGWAQGNMGGNSMFSQQSPPHFGQQAN
TSMYSNNMNINVSMATNTGGMSSMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRGG
NLFPNQLPGMDMIKQEGDTTRKYC
Download sequence
Identical sequences A0A2I3RZ80 Q15596
NP_001308632.1.87134 NP_001308632.1.92137 NP_001308636.1.87134 NP_001308636.1.92137 NP_006531.1.87134 NP_006531.1.92137 XP_009453764.1.37143 XP_009453765.1.37143 XP_016815039.1.37143 XP_016815040.1.37143 XP_016815041.1.37143 XP_016815042.1.37143 XP_016815043.1.37143 XP_016815044.1.37143 XP_016815045.1.37143 XP_016815046.1.37143 gi|5729858|ref|NP_006531.1| 9606.ENSP00000399968 ENSP00000399968 HR3538 IGBMC-0047-000 ENSPTRP00000034801 ENSP00000267974 ENSPTRP00000034801 ENSP00000399968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]