SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000400582 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000400582
Domain Number 1 Region: 913-1195
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.09e-57
Family Patatin 0.069
Further Details:      
 
Domain Number 2 Region: 575-691
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-21
Family cAMP-binding domain 0.0065
Further Details:      
 
Domain Number 3 Region: 130-268
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-20
Family cAMP-binding domain 0.023
Further Details:      
 
Domain Number 4 Region: 450-580
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.1e-19
Family cAMP-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000400582   Gene: ENSG00000130653   Transcript: ENST00000434090
Sequence length 1281
Comment pep:known chromosome:GRCh37:9:140355086:140442112:-1 gene:ENSG00000130653 transcript:ENST00000434090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTGIAVGALLALALVGVLILFMFRRLRQFRQAQPTPQYRFRKRDKVMFYGRKIMRKVTT
LPNTLVENTALPRQRARKRTKVLSLAKRILRFKKEYPALQPKEPPPSLLEADLTEFDVKN
SHLPSEVLYMLKNVRVLGHFEKPLFLELCKHIVFVQLQEGEHVFQPREPDPSICVVQDGR
LEVCIQDTDGTEVVVKEVLAGDSVHSLLSILDIITGHAAPYKTVSVRAAIPSTILRLPAA
AFHGVFEKYPETLVRVVQIIMVRLQRVTFLALHNYLGLTTELFNAESQAIPLVSVASVAA
GKAKKQVFYGEEERLKKPPRLQESCDSDHGGGRPAAAGPLLKRSHSVPAPSIRKQILEEL
EKPGAGDPDPSAPQGGPGSATSDLGMACDRARVFLHSDEHPGSSVASKSRKSVMVAEIPS
TVSQHSESHTDETLASRKSDAIFRAAKKDLLTLMKLEDSSLLDGRVALLHVPAGTVVSRQ
GDQDASILFVVSGLLHVYQRKIGSQEDTCLFLTRPGEMVGQLAVLTGEPLIFTVKANRDC
SFLSISKAHFYEIMRKQPTVVLGVAHTVVKRMSSFVRQIDFALDWVEVEAGRAIYRQGDK
SDCTYIMLSGRLRSVIRKDDGKKRLAGEYGRGDLVGVVETLTHQARATTVHAVRDSELAK
LPAGALTSIKRRYPQVVTRLIHLLGEKILGSLQQGPVTGHQLGLPTEGSKWDLGNPAVNL
STVAVMPVSEEVPLTAFALELEHALSAIGPTLLLTSDNIKRRLGSAALDSVHEYRLSSWL
GQQEDTHRIVLYQVDGTLTPWTQRCVRQADCILIVGLGDQEPTVGELERMLESTAVRAQK
QLILLHREEGPAPARTVEWLNMRSWCSGHLHLCCPRRVFSRRSLPKLVEMYKHVFQRPPD
RHSDFSRLARVLTGNAIALVLGGGGARGCAQVGVLKALAECGIPVDMVGGTSIGAFVGAL
YSEERNYSQMRIRAKQWAEGMTSLMKAALDLTYPITSMFSGAGFNSSIFSVFKDQQIEDL
WIPYFAITTDITASAMRVHTDGSLWWYVRASMSLSGYMPPLCDPKDGHLLMDGGYINNLP
ADVARSMGAKVVIAIDVGSRDETDLTNYGDALSGWWLLWKRWNPLATKVKVLNMAEIQTR
LAYVCCVRQLEVVKSSDYCEYLRPPIDSYSTLDFGKFNEICEVGYQHGRTVFDIWGRSGV
LEKMLRDQQGPSKKPASAVLTCPNASFTDLAEIVSRIEPAKPAMVDDESDYQTEYEEELL
DVPRDAYADFQSTSAQQGSDL
Download sequence
Identical sequences ENSP00000400582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]