SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000402648 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000402648
Domain Number 1 Region: 118-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-33
Family cAMP-binding domain 0.00000116
Further Details:      
 
Domain Number 2 Region: 15-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.23e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00028
Further Details:      
 
Domain Number 3 Region: 243-296
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000903
Family cAMP-binding domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000402648   Gene: ENSG00000188191   Transcript: ENST00000430040
Sequence length 297
Comment pep:known chromosome:GRCh37:7:618893:752577:-1 gene:ENSG00000188191 transcript:ENST00000430040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKE
ENRQILARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQG
EVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITE
Download sequence
Identical sequences C9JSK5
ENSP00000402648 ENSP00000402648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]