SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000403701 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403701
Domain Number 1 Region: 7-197
Classification Level Classification E-value
Superfamily E set domains 1.26e-75
Family Arrestin/Vps26-like 0.000000148
Further Details:      
 
Domain Number 2 Region: 199-414
Classification Level Classification E-value
Superfamily E set domains 4.67e-68
Family Arrestin/Vps26-like 0.0000000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403701   Gene: ENSG00000141480   Transcript: ENST00000412477
Sequence length 430
Comment pep:novel chromosome:GRCh37:17:4613988:4624791:1 gene:ENSG00000141480 transcript:ENST00000412477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTV
RMPLPSEGQGAGAGTVSGVGIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKS
HKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNV
HVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLL
SDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVE
LPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGM
KDDDYDDQLC
Download sequence
Identical sequences G1S6G2
ENSP00000403701 ENSP00000458371 NP_001244257.1.87134 NP_001244257.1.92137 XP_003277908.1.23891 ENSP00000403701 ENSNLEP00000021101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]