SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000403711 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000403711
Domain Number 1 Region: 5-69
Classification Level Classification E-value
Superfamily E set domains 4.2e-16
Family Transglutaminase N-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000403711   Gene: ENSG00000163810   Transcript: ENST00000422219
Sequence length 91
Comment pep:known chromosome:GRCh37:3:44916127:44943062:1 gene:ENSG00000163810 transcript:ENST00000422219 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MMDASKELQVLHIDFLNQDNAVSHHTWEFQTSSPVFRRGQVFHLRLVLNQPLQSYHQLKL
EFSTGHSGCHQFPQCHPGQVPTKRENWKPHP
Download sequence
Identical sequences F8WCU8
ENSP00000403711 ENSP00000403711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]