SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000404435 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000404435
Domain Number 1 Region: 29-178
Classification Level Classification E-value
Superfamily E set domains 3.18e-44
Family RhoGDI-like 0.00000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000404435   Gene: ENSG00000242173   Transcript: ENST00000447871
Sequence length 178
Comment pep:novel chromosome:GRCh37:16:330450:332688:1 gene:ENSG00000242173 transcript:ENST00000447871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIR
QLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKD
QVFVLKEGVDYRVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVE
Download sequence
Identical sequences A0A2J8INF6 A0A2J8R2F2 A2ID99
ENSP00000404435 ENSP00000404435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]