SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405063 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000405063
Domain Number - Region: 7-77,110-159
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000732
Family Apolipoprotein A-I 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405063   Gene: ENSG00000008517   Transcript: ENST00000440815
Sequence length 188
Comment pep:known chromosome:GRCh37:16:3115370:3119552:1 gene:ENSG00000008517 transcript:ENST00000440815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAA
YYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQ
TWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQK
CSEPQSSK
Download sequence
Identical sequences ENSP00000324742 ENSP00000405063 ENSP00000411958 ENSP00000432218 ENSP00000432850 ENSP00000432917 ENSP00000436929 ENSP00000437020 ENSP00000448683 ENSP00000450364 ENSP00000324742 ENSP00000405063 ENSP00000411958 ENSP00000432218 ENSP00000432850 ENSP00000432917 ENSP00000436929 ENSP00000437020 ENSP00000448683 ENSP00000450364 9606.ENSP00000324742 NP_001012649.1.87134 NP_001012649.1.92137 NP_001012650.1.87134 NP_001012650.1.92137 NP_001012736.1.87134 NP_001012736.1.92137 NP_004212.4.87134 NP_004212.4.92137 HR2801 gi|61639466|ref|NP_001012649.1| gi|61639471|ref|NP_004212.4| gi|61658632|ref|NP_001012650.1| gi|61658642|ref|NP_001012736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]