SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000405754 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405754
Domain Number 1 Region: 52-313,348-493
Classification Level Classification E-value
Superfamily Clc chloride channel 1.31e-120
Family Clc chloride channel 0.0000922
Further Details:      
 
Domain Number 2 Region: 492-653
Classification Level Classification E-value
Superfamily CBS-domain pair 1.02e-30
Family CBS-domain pair 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405754   Gene: ENSG00000073464   Transcript: ENST00000421085
Sequence length 666
Comment pep:known chromosome:GRCh37:X:10126540:10201760:1 gene:ENSG00000073464 transcript:ENST00000421085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDLKEGVCLSAFWYSHEQCCWTSNETTFEDRDKCPLWQKWSELLVNQSEGASAYILNYL
MYILWALLFAFLAVSLVRVFAPYACGSGIPEIKTILSGFIIRGYLGKWTLLIKTVTLVLV
VSSGLSLGKEGPLVHVACCCGNFFSSLFSKYSKNEGKRREVLSAAAAAGVSVAFGAPIGG
VLFSLEEVSYYFPLKTLWRSFFAALVAAFTLRSINPFGNSRLVLFYVEYHTPWYMAELFP
FILLGVFGGLWGTLFIRCNIAWCRRRKTTRLGKYPVLEVIVVTAITAIIAYPNPYTRQST
SELISELFNDCGALESSQLCDYINDPNMTRPVDDIPDRPAGVGVYTAMWQLALALIFKIV
VTIFTFGMKIPSGLFIPSMAVGAIAGRMVGIGVEQLAYHHHDWIIFRNWCRPGADCVTPG
LYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMAAAVTSKWVADAFGKEGIYEA
HIHLNGYPFLDVKDEFTHRTLATDVMRPRRGEPPLSVLTQDSMTVEDVETLIKETDYNGF
PVVVSRDSERLIGFAQRRELILAIKNARQRQEGIVSNSIMYFTEEPPELPANSPHPLKLR
RILNLSPFTVTDHTPMETVVDIFRKLGLRQCLVTRSGRLLGIITKKDVLRHMAQMANQDP
ESIMFN
Download sequence
Identical sequences A0A2J8J8Q4 A0A2J8W4S1 F7CC32
ENSP00000405754 ENSCJAP00000001672 ENSP00000405754 NP_001243873.1.87134 NP_001243873.1.92137 XP_004092404.1.23891 XP_011806291.1.43180 XP_011822223.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]