SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000405929 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405929
Domain Number 1 Region: 67-168
Classification Level Classification E-value
Superfamily CBS-domain pair 0.000000000000021
Family CBS-domain pair 0.0037
Further Details:      
 
Domain Number 2 Region: 2-49
Classification Level Classification E-value
Superfamily Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.000037
Family Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405929   Gene: ENSG00000160200   Transcript: ENST00000430013
Sequence length 224
Comment pep:putative chromosome:GRCh37:21:44475708:44480656:-1 gene:ENSG00000160200 transcript:ENST00000430013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKK
PWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLS
SLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQSQDQAWAGV
VGGPAGSPNQVFLEHVHACHHRLWLLSSTSGLRAHNRDGTAPKT
Download sequence
Identical sequences H7C2H4
ENSP00000405929 ENSP00000405929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]