SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000406320 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406320
Domain Number 1 Region: 148-345
Classification Level Classification E-value
Superfamily E set domains 2.85e-74
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000047
Further Details:      
 
Domain Number 2 Region: 42-164
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-20
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406320   Gene: ENSG00000151704   Transcript: ENST00000440599
Sequence length 372
Comment pep:novel chromosome:GRCh37:11:128707952:128737265:-1 gene:ENSG00000151704 transcript:ENST00000440599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQSRFIFFVDIWTTVLDLKWRY
KMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTPCVENINGLTSAFLFSLETQ
VTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILAKISRPKKRAKTITFSKNAV
ISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNEN
LFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSATCQVRTSYVPEEV
LWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFI
LSEVNETDDTKM
Download sequence
Identical sequences A0A024R3K6
ENSP00000316233 ENSP00000376433 ENSP00000376434 ENSP00000406320 gi|148539892|ref|NP_722449.2| gi|24497467|ref|NP_722448.1| gi|24497471|ref|NP_722450.1| gi|24497473|ref|NP_722451.1| NP_722448.1.87134 NP_722448.1.92137 NP_722450.1.87134 NP_722450.1.92137 NP_722451.1.87134 NP_722451.1.92137 ENSP00000316233 ENSP00000376433 ENSP00000376434 ENSP00000406320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]