SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000406544 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406544
Domain Number 1 Region: 133-291
Classification Level Classification E-value
Superfamily CBS-domain pair 1.2e-41
Family CBS-domain pair 0.000000158
Further Details:      
 
Domain Number 2 Region: 296-432
Classification Level Classification E-value
Superfamily CBS-domain pair 2.53e-31
Family CBS-domain pair 0.00000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406544   Gene: ENSG00000106617   Transcript: ENST00000433631
Sequence length 444
Comment pep:known chromosome:GRCh37:7:151253247:151433349:-1 gene:ENSG00000106617 transcript:ENST00000433631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRFGSLRSNKKHKDQNRSTERRQSEPHGLFASGLSSSPSTPTQVTKQHTFPLESYKHEP
ERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEAGMLE
KLEFEDEVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAP
LWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNIS
PDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQNL
DELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEK
TYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGII
SLSDILQALILTPAGAKQKETETE
Download sequence
Identical sequences NP_001291456.1.87134 NP_001291456.1.92137 XP_003318974.1.37143 ENSP00000406544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]