SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000406833 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000406833
Domain Number 1 Region: 6-144
Classification Level Classification E-value
Superfamily E set domains 3.92e-21
Family Arrestin/Vps26-like 0.022
Further Details:      
 
Domain Number 2 Region: 146-252
Classification Level Classification E-value
Superfamily E set domains 0.00000000385
Family E-set domains of sugar-utilizing enzymes 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000406833   Gene: ENSG00000197070   Transcript: ENST00000419386
Sequence length 271
Comment pep:known chromosome:GRCh37:9:140500155:140509137:1 gene:ENSG00000197070 transcript:ENST00000419386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRVQLFEISLSHGRVVYSPGEPLAGTVRVRLGAPLPFRAIRVTCIGSCGVSNKANDTAW
VVEEGYFNSSLSLADKGSLPAGEHSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHTPRF
SKDHKCSLVFYILSPLNLNSIPDIEALQLHADVENQSGKDTSPVVASLLQKVSYKAKRWI
HDVRTIAEVEGAGVKAWRRAQWHEQILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVT
LPVFIGNIAVNHAPVSPRPGLGLPPGAPPLV
Download sequence
Identical sequences Q5T370
ENSP00000406833 ENSP00000406833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]