SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000407284 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407284
Domain Number 1 Region: 65-180
Classification Level Classification E-value
Superfamily E set domains 1.07e-31
Family Cytoplasmic domain of inward rectifier potassium channel 0.0019
Further Details:      
 
Domain Number 2 Region: 21-81
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000518
Family Voltage-gated potassium channels 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407284   Gene: ENSG00000115474   Transcript: ENST00000438786
Sequence length 184
Comment pep:putative chromosome:GRCh37:2:233633191:233641265:-1 gene:ENSG00000115474 transcript:ENST00000438786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTIGYGTMFPSGDCPSAIALLAI
QMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDTAVVAHMDGKPNLIFQVANTRPSPLT
SVRVSAVLYQERENGKLYQTSVDFHLDGISSDECPFFIFPLTYYHSITPSSPLATLLQHE
NPSH
Download sequence
Identical sequences C9JWD6
ENSP00000407284 ENSP00000407284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]