SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000407661 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407661
Domain Number 1 Region: 17-48
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000278
Family RING finger domain, C3HC4 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407661   Gene: ENSG00000226437   Transcript: ENST00000450170
Sequence length 48
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_MANN:30339971:30341911:1 gene:ENSG00000226437 transcript:ENST00000450170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETSLLEAGASAASTAAALENLQVEASCSVCLEYLKEPVIIECGHNF
Download sequence
Identical sequences A2AAZ2
ENSP00000388852 ENSP00000397952 ENSP00000398442 ENSP00000403073 ENSP00000405274 ENSP00000407661 ENSP00000415953 ENSP00000388852 ENSP00000397952 ENSP00000398442 ENSP00000403073 ENSP00000405274 ENSP00000407661 ENSP00000415953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]