SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000407829 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407829
Domain Number 1 Region: 16-106
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000247
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407829   Gene: ENSG00000070882   Transcript: ENST00000415162
Sequence length 112
Comment pep:known chromosome:GRCh37:7:24910394:24957712:-1 gene:ENSG00000070882 transcript:ENST00000415162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLK
KRKWPLKGWHKRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSS
Download sequence
Identical sequences C9JZ19
ENSP00000407829 ENSP00000407829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]