SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000408014 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408014
Domain Number 1 Region: 7-102
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000000000000215
Family CBS-domain pair 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408014   Gene: ENSG00000160200   Transcript: ENST00000458223
Sequence length 159
Comment pep:putative chromosome:GRCh37:21:44475693:44479064:-1 gene:ENSG00000160200 transcript:ENST00000458223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGK
VQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQSQDQAWAGVVGGPAE
KKKDANSNVRVPKSSLPGACPRLSPPSVAAFKHVRAACS
Download sequence
Identical sequences H7C2W0
ENSP00000408014 ENSP00000408014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]