SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000408921 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408921
Domain Number 1 Region: 18-250
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-81
Family Calponin-homology domain, CH-domain 0.000087
Further Details:      
 
Domain Number 2 Region: 366-465
Classification Level Classification E-value
Superfamily E set domains 4.4e-27
Family Filamin repeat (rod domain) 0.00086
Further Details:      
 
Domain Number 3 Region: 265-361
Classification Level Classification E-value
Superfamily E set domains 7.34e-26
Family Filamin repeat (rod domain) 0.00076
Further Details:      
 
Domain Number 4 Region: 443-510
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000018
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408921   Gene: ENSG00000196924   Transcript: ENST00000420627
Sequence length 604
Comment pep:known chromosome:GRCh37:X:153576892:153599571:-1 gene:ENSG00000196924 transcript:ENST00000420627 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
AAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDG
LRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNL
KLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQS
GRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLGIPQVITPEEIVDPNVDE
HSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQG
EVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYV
DKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEPQL
EARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAVGRGLQPKG
VRVKETADFKVYTKGAGSGELKVTVKGPRRGAREAEGPGGWRVWLRVLPHGPWNLYRHHH
VGWSEHRAQSLRSEGGHRVWQSEGTGLGPWAGGRRRWQVSRLCGGGYRGRRGHAGLLGGR
AIAG
Download sequence
Identical sequences F8WE98
ENSP00000408921 ENSP00000408921 ENSP00000470861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]