SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000408937 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000408937
Domain Number 1 Region: 14-166
Classification Level Classification E-value
Superfamily E set domains 9.1e-63
Family Arrestin/Vps26-like 0.00000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000408937   Gene: ENSG00000130561   Transcript: ENST00000447536
Sequence length 169
Comment pep:known chromosome:GRCh37:2:234216462:234235838:1 gene:ENSG00000130561 transcript:ENST00000447536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKK
VYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTY
PFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIP
Download sequence
Identical sequences E7ESX4
ENSP00000408937 ENSP00000408937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]