SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000409018 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409018
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily SH2 domain 1.2e-27
Family SH2 domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409018   Gene: ENSG00000168918   Transcript: ENST00000422935
Sequence length 220
Comment pep:known chromosome:GRCh37:2:233924677:233995358:1 gene:ENSG00000168918 transcript:ENST00000422935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNED
DKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQYPVPLEEEDTGDDPEEDTESVV
SPPELPPRNIPLTASSCEAKEVPFSNENPRATETSRPSLSETLFQRLQSMDTSGLPEEHL
KAIQDYLSTQLAQDSEFVKTGSSSLPHLKKLTTLLCKELY
Download sequence
Identical sequences ENSP00000409018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]