SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000409171 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409171
Domain Number 1 Region: 24-466
Classification Level Classification E-value
Superfamily Sema domain 1.16e-118
Family Sema domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1313-1442,1619-1805
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-49
Family p120GAP domain-like 0.019
Further Details:      
 
Domain Number 3 Region: 892-981
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000187
Family Other IPT/TIG domains 0.04
Further Details:      
 
Domain Number 4 Region: 800-894
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000323
Family Other IPT/TIG domains 0.0077
Further Details:      
 
Domain Number 5 Region: 469-518
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000471
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 980-1094
Classification Level Classification E-value
Superfamily E set domains 0.00000485
Family E-set domains of sugar-utilizing enzymes 0.039
Further Details:      
 
Weak hits

Sequence:  ENSP00000409171
Domain Number - Region: 764-797
Classification Level Classification E-value
Superfamily Plexin repeat 0.0314
Family Plexin repeat 0.0041
Further Details:      
 
Domain Number - Region: 1466-1558
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0653
Family Ubiquitin-related 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409171   Gene: ENSG00000196576   Transcript: ENST00000449103
Sequence length 1838
Comment pep:known chromosome:GRCh37:22:50713408:50746056:-1 gene:ENSG00000196576 transcript:ENST00000449103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQLWALTLLGLLGAGASLRPRKLDFFRSEKELNHLAVDEASGVVYLGAVNALYQLDAK
LQLEQQVATGPALDNKKCTPPIEASQCHEAEMTDNVNQLLLLDPPRKRLVECGSLFKGIC
ALRALSNISLRLFYEDGSGEKSFVASNDEGVATVGLVSSTGPGGDRVLFVGKGNGPHDNG
IIVSTRLLDRTDSREAFEAYTDHATYKAGYLSTNTQQFVAAFEDGPYVFFVFNQQDKHPA
RNRTLLARMCREDPNYYSYLEMDLQCRDPDIHAAAFGTCLAASVAAPGSGRVLYAVFSRD
SRSSGGPGAGLCLFPLDKVHAKMEANRNACYTGTREARDIFYKPFHGDIQCGGHAPGSSK
SFPCGSEHLPYPLGSRDGLRGTAVLQRGGLNLTAVTVAAENNHTVAFLGTSDGRILKVYL
TPDGTSSEYDSILVEINKRVKRDLVLSGDLGSLYAMTQDKVFRLPVQECLSYPTCTQCRD
SQDPYCGWCVVEGRCTRKAECPRAEEASHWLWSRSKSCVAVTSAQPQNMSRRAQGEVQLT
VSPLPALSEEDELLCLFGESPPHPARVEGEAVICNSPSSIPVTPPGQDHVAVTIQLLLRR
GNIFLTSYQYPFYDCRQAMSLEENLPCISCVSNRWTCQWDLRYHECREASPNPEDGIVRA
HMEDSCPQFLGPSPLVIPMNHETDVNFQGKNLDTVKGSSLHVGSDLLKFMEPVTMQESGT
FAFRTPKLSHDANETLPLHLYVKSYGKNIDSKLHVTLYNCSFGRSDCSLCRAANPDYRCA
WCGGQSRCVYEALCNTTSECPPPVITRIQPETGPLGGGIRITILGSNLGVQAGDIQRISV
AGRNCSFQPERYSVSTRIVCVIEAAETPFTGGVEVDVFGKLGRSPPNVQFTFQQPKPLSV
EPQQGPQAGGTTLTIHGTHLDTGSQEDVRVTLNGVPCKVTKFGAQLQCVTGPQATRGQML
LEVSYGGSPVPNPGIFFTYRENPVLRAFEPLRSFASGGRSINVTGQGFSLIQRFAMVVIA
EPLQSWQPPREAESLQPMTVVGTDYVFHNDTKVVFLSPAVPEEPEAYNLTVLIEMDGHRA
LLRTEAGAFEYVPDPTFENFTGGVKKQVNKLIHARGTNLNKAMTLQEAEAFVGAERCTMK
TLTETDLYCEPPEVQPPPKRRQKRDTTHNLPEFIVKFGSREWVLGRVEYDTRVSDVPLSL
ILPLVIVPMVVVIAVSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIEM
EDQTNDVHEAGIPVLDYKTYTDRVFFLPSKDGDKDVMITGKLDIPEPRRPVVEQALYQFS
NLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMHTLFLELLEQY
VVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVDAV
QKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVKVLNCDTISQVKEKIIDQVYR
GQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSK
VGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVKEKERTKAITEI
YLTRLLSVKGTLQQFVDNFFQSVLAPGHAVPPAVKYFFDFLDEQAEKHNIQDEDTIHIWK
TNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLL
YAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQK
YYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTDL
Download sequence
Identical sequences O15031
ENSP00000352288 ENSP00000409171 ENSP00000352288 9606.ENSP00000352288 NYSGRC-149363636 NP_036533.2.87134 NP_036533.2.92137 XP_005261966.1.92137 XP_005261967.1.92137 XP_005261968.1.92137 XP_006724476.1.92137 XP_016884192.1.92137 XP_016884193.1.92137 gi|149363636|ref|NP_036533.2| ENSP00000352288 ENSP00000409171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]