SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000409239 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409239
Domain Number 1 Region: 8-82
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.27e-18
Family cAMP-binding domain 0.0000518
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409239   Gene: ENSG00000114302   Transcript: ENST00000457914
Sequence length 92
Comment pep:putative chromosome:GRCh37:3:48782030:48789751:-1 gene:ENSG00000114302 transcript:ENST00000457914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLG
PCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ
Download sequence
Identical sequences H7C330
ENSP00000409239 ENSP00000409239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]