SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000409475 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409475
Domain Number 1 Region: 14-64
Classification Level Classification E-value
Superfamily E set domains 6.93e-16
Family Arrestin/Vps26-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409475   Gene: ENSG00000130561   Transcript: ENST00000415974
Sequence length 130
Comment pep:novel chromosome:GRCh37:2:234216531:234227650:1 gene:ENSG00000130561 transcript:ENST00000415974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKK
GEMKPLVSGWFLGGVDCSLGGSGKGHLHGRRDRKAEAALLHMEPVPGPLTHTPVPNSRDI
GPVDTRAHSL
Download sequence
Identical sequences C9JSX4
ENSP00000409475 ENSP00000409475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]