SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000410541 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000410541
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily E set domains 2.8e-45
Family RhoGDI-like 0.00000681
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410541   Gene: ENSG00000242173   Transcript: ENST00000414650
Sequence length 116
Comment pep:putative chromosome:GRCh37:16:330855:332810:1 gene:ENSG00000242173 transcript:ENST00000414650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVG
SYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWK
Download sequence
Identical sequences C9J3B5
ENSP00000410541 ENSP00000410541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]