SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000410833 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000410833
Domain Number 1 Region: 184-598
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.1e-87
Family Amylase, catalytic domain 0.0000871
Further Details:      
 
Domain Number 2 Region: 600-697
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 6.11e-26
Family alpha-Amylases, C-terminal beta-sheet domain 0.0069
Further Details:      
 
Domain Number 3 Region: 69-181
Classification Level Classification E-value
Superfamily E set domains 2e-19
Family E-set domains of sugar-utilizing enzymes 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410833   Gene: ENSG00000114480   Transcript: ENST00000429644
Sequence length 702
Comment pep:known chromosome:GRCh37:3:81538850:81811312:-1 gene:ENSG00000114480 transcript:ENST00000429644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIG
ENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYG
KWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDP
EHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAI
MEHAYYASFGYQITSFFAASSRYGTPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGL
NMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEILRFLLSNIRWWLEEYRFDGFRFDGVT
SMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPAL
CSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESH
DQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMG
NEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAP
QAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGH
QRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN
Download sequence
Identical sequences Q04446
ENSP00000410833 ENSP00000410833 9606.ENSP00000410833 ENSP00000410833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]