SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000410980 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000410980
Domain Number 1 Region: 40-515
Classification Level Classification E-value
Superfamily Sema domain 1.7e-158
Family Sema domain 0.000000000000011
Further Details:      
 
Domain Number 2 Region: 654-728
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000165
Family E-set domains of sugar-utilizing enzymes 0.034
Further Details:      
 
Domain Number 3 Region: 561-657
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000204
Family Other IPT/TIG domains 0.056
Further Details:      
 
Domain Number 4 Region: 517-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000654
Family Plexin repeat 0.0000401
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410980   Gene: ENSG00000105976   Transcript: ENST00000436117
Sequence length 764
Comment pep:known chromosome:GRCh37:7:116339139:116403134:1 gene:ENSG00000105976 transcript:ENST00000436117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT
SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFIRHVNIALIQR
Download sequence
Identical sequences ENSP00000410980 ENSP00000410980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]