SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000411114 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411114
Domain Number 1 Region: 33-134
Classification Level Classification E-value
Superfamily E set domains 4.9e-25
Family Transglutaminase N-terminal domain 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411114   Gene: ENSG00000124491   Transcript: ENST00000451619
Sequence length 147
Comment pep:putative chromosome:GRCh37:6:6305346:6320875:-1 gene:ENSG00000124491 transcript:ENST00000451619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEAHRASPREGTSGGERLQDLVKSKMSETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGV
VPRGVNLQEFLNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDP
RRDLFRVEYVIGECHVQAPVLTPWVAL
Download sequence
Identical sequences H0Y796
ENSP00000411114 ENSP00000411114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]