SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000411690 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411690
Domain Number 1 Region: 96-180
Classification Level Classification E-value
Superfamily E set domains 0.00000000238
Family Filamin repeat (rod domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411690   Gene: ENSG00000095110   Transcript: ENST00000424269
Sequence length 547
Comment pep:known chromosome:GRCh37:11:114392438:114421923:-1 gene:ENSG00000095110 transcript:ENST00000424269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNTMLQKTLLILISFSVVTWMIFIISQNFTKLWSALNLSISVHYWNNSAKSLFPKTSL
IPLKPLTETELRIKEIIEKLDQQIPPRPFTHVNTTTSATHSTATILNPRDTYCRGDQLDI
LLEVRDHLGQRKQYGGDFLRARMSSPALTAGASGKVMDFNNGTYLVSFTLFWEGQVSLSL
LLIHPSEGASALWRARNQGYDKIIFKGKFVNGTSHVFTECGLTLNSNAELCEYLDDRDQE
AFYCMKPQHMPCEALTYMTTRNREVSYLTDKENSLFHRSKVGVEMMKDRKHIDVTNCNKR
EKIEETCQVGMKPPVPGGYTLQGKWITTFCNQVQLDTIKINGCLKGKLIYLLGDSTLRQW
IYYFPKVVKTLKFFDLHETGIFKKHLLLDAERHTQIQWKKHSYPFVTFQLYSLIDHDYIP
REIDRLSGDKNTAIVITFGQHFRPFPIDIFIRRAIGVQKAIERLFLRSPATKVIIKTENI
REMHIETERFGDFHGYIHYLIMKDIFKDLNVGIIDAWDMTIAYGTDTIHPPDHVIGNQIN
MFLNYIC
Download sequence
Identical sequences Q8N323
ENSP00000251921 ENSP00000411690 NYSGRC-IgSF-FA55A_HUMAN XP_011540896.1.92137 XP_011540897.1.92137 XP_011540898.1.92137 XP_011540899.1.92137 XP_011540900.1.92137 XP_011540901.1.92137 ENSP00000411690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]