SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411936 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411936
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-40
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411936   Gene: ENSG00000130762   Transcript: ENST00000445297
Sequence length 146
Comment pep:putative chromosome:GRCh37:1:3385108:3390085:1 gene:ENSG00000130762 transcript:ENST00000445297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQ
RHKAQVLVEDISDILEEHAEKHFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERR
PACGGLPMLSFLILPMQRVTRLPLLM
Download sequence
Identical sequences B0QZD3
ENSP00000411936 ENSP00000411936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]