SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000412103 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412103
Domain Number 1 Region: 21-147
Classification Level Classification E-value
Superfamily E set domains 1.59e-42
Family ML domain 0.000000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412103   Gene: ENSG00000119655   Transcript: ENST00000434013
Sequence length 201
Comment pep:putative chromosome:GRCh37:14:74942895:74960010:-1 gene:ENSG00000119655 transcript:ENST00000434013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVT
FTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYP
SIKLVVEWQLQDDKNQSLFCWEIPVQIMFPCLFSAHCPMLATEHRCLQLQMETKSLRFWS
RRGMSVWLPSPAGAWRRTAPF
Download sequence
Identical sequences E7EMS2
ENSP00000412103 ENSP00000412103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]