SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000412180 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412180
Domain Number 1 Region: 23-79
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000011
Family Protein kinases, catalytic subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412180   Gene: ENSG00000139908   Transcript: ENST00000428351
Sequence length 135
Comment pep:putative chromosome:GRCh37:14:24675064:24677454:1 gene:ENSG00000139908 transcript:ENST00000428351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGDVLEAAPTTTAYHSLMDEYGYEVGKAIGHGSYGSVYEAFYTKQKVMVAVKIISKKK
ASDDYLNKFLPREIQNLILQMLRQATKRATILDIIKDSWVLKFQPEQPTHEIRLLEAMCQ
LHNTTKQHQSLQITT
Download sequence
Identical sequences H7C3J1
ENSP00000412180 ENSP00000412180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]