SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000412936 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000412936
Domain Number - Region: 7-31
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00779
Family PDZ domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412936   Gene: ENSG00000120913   Transcript: ENST00000416159
Sequence length 38
Comment pep:known chromosome:GRCh37:8:22438113:22447249:1 gene:ENSG00000120913 transcript:ENST00000416159 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MALTVDVAGPAPWGFRITGGRDFHTPIMVTKAAIWGDY
Download sequence
Identical sequences F8WFB8
ENSP00000412936 ENSP00000412936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]