SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000413334 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000413334
Domain Number 1 Region: 8-136
Classification Level Classification E-value
Superfamily E set domains 5.6e-36
Family Transglutaminase N-terminal domain 0.000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413334   Gene: ENSG00000124491   Transcript: ENST00000414279
Sequence length 138
Comment pep:known chromosome:GRCh37:6:6266946:6321246:-1 gene:ENSG00000124491 transcript:ENST00000414279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGVVPRGVNLQEFLNVTSVHLFKERWDT
NKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPV
PIVSELQSGKWGAKIVMR
Download sequence
Identical sequences Q9NQP5
ENSP00000413334 ENSP00000413334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]