SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000414409 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000414409
Domain Number - Region: 23-83
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0026
Family cAMP-binding domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414409   Gene: ENSG00000132429   Transcript: ENST00000429112
Sequence length 101
Comment pep:putative chromosome:GRCh37:6:105606456:105607996:-1 gene:ENSG00000132429 transcript:ENST00000429112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFLCFDRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRR
KKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKR
Download sequence
Identical sequences A0A2J8PUS3 A0A2J8SG17 Q5T554
ENSP00000414409 ENSP00000414409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]