SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000414487 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414487
Domain Number 1 Region: 155-243
Classification Level Classification E-value
Superfamily E set domains 3.78e-24
Family Cytoplasmic domain of inward rectifier potassium channel 0.0012
Further Details:      
 
Domain Number 2 Region: 49-169
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.24e-19
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414487   Gene: ENSG00000157551   Transcript: ENST00000438657
Sequence length 245
Comment pep:known chromosome:GRCh37:21:39644217:39671919:1 gene:ENSG00000157551 transcript:ENST00000438657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAIHIGMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSES
Download sequence
Identical sequences A0A2J8M7T2 E7EPG3
ENSP00000414487 ENSP00000414487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]