SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000414532 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414532
Domain Number 1 Region: 1136-1248
Classification Level Classification E-value
Superfamily E set domains 2.07e-35
Family Filamin repeat (rod domain) 0.00000262
Further Details:      
 
Domain Number 2 Region: 1250-1358
Classification Level Classification E-value
Superfamily E set domains 2.67e-33
Family Filamin repeat (rod domain) 0.00000307
Further Details:      
 
Domain Number 3 Region: 1047-1158
Classification Level Classification E-value
Superfamily E set domains 1.33e-31
Family Filamin repeat (rod domain) 0.000000834
Further Details:      
 
Domain Number 4 Region: 1325-1442
Classification Level Classification E-value
Superfamily E set domains 5.74e-31
Family Filamin repeat (rod domain) 0.0000281
Further Details:      
 
Domain Number 5 Region: 1423-1538
Classification Level Classification E-value
Superfamily E set domains 5.94e-31
Family Filamin repeat (rod domain) 0.0000039
Further Details:      
 
Domain Number 6 Region: 868-958
Classification Level Classification E-value
Superfamily E set domains 1.07e-30
Family Filamin repeat (rod domain) 0.00000301
Further Details:      
 
Domain Number 7 Region: 261-378
Classification Level Classification E-value
Superfamily E set domains 1e-29
Family Filamin repeat (rod domain) 0.00065
Further Details:      
 
Domain Number 8 Region: 551-674
Classification Level Classification E-value
Superfamily E set domains 6.47e-29
Family Filamin repeat (rod domain) 0.00087
Further Details:      
 
Domain Number 9 Region: 1637-1732
Classification Level Classification E-value
Superfamily E set domains 1.87e-28
Family Filamin repeat (rod domain) 0.0000128
Further Details:      
 
Domain Number 10 Region: 654-774
Classification Level Classification E-value
Superfamily E set domains 2.34e-28
Family Filamin repeat (rod domain) 0.00044
Further Details:      
 
Domain Number 11 Region: 2008-2104
Classification Level Classification E-value
Superfamily E set domains 4.87e-27
Family Filamin repeat (rod domain) 0.00000992
Further Details:      
 
Domain Number 12 Region: 474-582
Classification Level Classification E-value
Superfamily E set domains 5.47e-27
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 13 Region: 961-1070
Classification Level Classification E-value
Superfamily E set domains 1.53e-26
Family Filamin repeat (rod domain) 0.00000305
Further Details:      
 
Domain Number 14 Region: 1818-1913
Classification Level Classification E-value
Superfamily E set domains 1.53e-26
Family Filamin repeat (rod domain) 0.00000323
Further Details:      
 
Domain Number 15 Region: 183-282
Classification Level Classification E-value
Superfamily E set domains 3.12e-25
Family Filamin repeat (rod domain) 0.00084
Further Details:      
 
Domain Number 16 Region: 83-180
Classification Level Classification E-value
Superfamily E set domains 3.34e-25
Family Filamin repeat (rod domain) 0.00086
Further Details:      
 
Domain Number 17 Region: 2331-2421
Classification Level Classification E-value
Superfamily E set domains 6.34e-25
Family Filamin repeat (rod domain) 0.0000165
Further Details:      
 
Domain Number 18 Region: 2202-2293
Classification Level Classification E-value
Superfamily E set domains 1.8e-24
Family Filamin repeat (rod domain) 0.0000148
Further Details:      
 
Domain Number 19 Region: 2109-2200
Classification Level Classification E-value
Superfamily E set domains 5.2e-24
Family Filamin repeat (rod domain) 0.0000166
Further Details:      
 
Domain Number 20 Region: 368-470
Classification Level Classification E-value
Superfamily E set domains 6.01e-24
Family Filamin repeat (rod domain) 0.0002
Further Details:      
 
Domain Number 21 Region: 782-883
Classification Level Classification E-value
Superfamily E set domains 6.03e-22
Family Filamin repeat (rod domain) 0.00086
Further Details:      
 
Domain Number 22 Region: 1719-1816
Classification Level Classification E-value
Superfamily E set domains 8.67e-22
Family Filamin repeat (rod domain) 0.00000261
Further Details:      
 
Domain Number 23 Region: 1930-2025
Classification Level Classification E-value
Superfamily E set domains 6.21e-21
Family Filamin repeat (rod domain) 0.00001
Further Details:      
 
Domain Number 24 Region: 1575-1651
Classification Level Classification E-value
Superfamily E set domains 3.27e-16
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 
Domain Number 25 Region: 16-74
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000627
Family Calponin-homology domain, CH-domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414532   Gene: ENSG00000136068   Transcript: ENST00000419752
Sequence length 2422
Comment pep:known chromosome:GRCh37:3:58064213:58157982:1 gene:ENSG00000136068 transcript:ENST00000419752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEHSTRRRSLSLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHS
VMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDV
MVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDK
AQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDK
GNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRI
RETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITW
GGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGP
SQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVR
AYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYT
PVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDC
TEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQE
IPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLP
GDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKL
NGLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPR
EEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAG
TGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEM
PFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGT
YAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATT
DFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYD
DVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPS
ESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGP
GLGSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEG
PYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGE
GLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRAT
QTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENED
GTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQ
EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPV
IAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTG
IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPN
HIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGD
YVLAVKWGEEHIPGSPFHVTVP
Download sequence
Identical sequences ENSP00000414532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]