SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000414639 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414639
Domain Number 1 Region: 79-199
Classification Level Classification E-value
Superfamily E set domains 1.05e-37
Family RhoGDI-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414639   Gene: ENSG00000109103   Transcript: ENST00000444148
Sequence length 208
Comment pep:novel chromosome:GRCh37:17:26874660:26879627:-1 gene:ENSG00000109103 transcript:ENST00000444148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPI
GPEDVLGLQRITGGARPLFPAWRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGR
FVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSK
NTCEHIYDFPPLSEELSARAGSSGSGEV
Download sequence
Identical sequences C9JSK0
ENSP00000414639 ENSP00000414639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]