SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000415812 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000415812
Domain Number 1 Region: 483-742
Classification Level Classification E-value
Superfamily NHL repeat 2.22e-47
Family NHL repeat 0.00000725
Further Details:      
 
Domain Number 2 Region: 333-429
Classification Level Classification E-value
Superfamily E set domains 1.6e-22
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 109-171
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000168
Family B-box zinc-binding domain 0.002
Further Details:      
 
Domain Number 4 Region: 18-92
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000353
Family RING finger domain, C3HC4 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000415812   Gene: ENSG00000109654   Transcript: ENST00000437508
Sequence length 744
Comment pep:known chromosome:GRCh37:4:154074270:154257514:1 gene:ENSG00000109654 transcript:ENST00000437508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEGTNIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSC
PVCRQTSILPEKGVAALQNNFFITNLMDVLQRTPGSNAEESSILETVTAVAAGKPLSCPN
HDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEID
SALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQ
LDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLD
FIVETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTIIGQPMSVTITTKDKDGELCKT
GNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLK
VIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKG
RNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA
VHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVF
IFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFG
SNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLA
LTSDGHVVVADSGNHCFKVYRYLQ
Download sequence
Identical sequences Q9C040
ENSP00000415812 gi|194248081|ref|NP_001123539.1| ENSP00000415812 NP_001123539.1.87134 NP_001123539.1.92137 XP_016863433.1.92137 XP_016863434.1.92137 XP_016863437.1.92137 XP_016863438.1.92137 XP_016863439.1.92137 XP_016863440.1.92137 XP_016863441.1.92137 XP_018881191.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]