SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000416438 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416438
Domain Number 1 Region: 16-79
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000013
Family cAMP-binding domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416438   Gene: ENSG00000114302   Transcript: ENST00000438535
Sequence length 99
Comment pep:putative chromosome:GRCh37:3:48788772:48802783:-1 gene:ENSG00000114302 transcript:ENST00000438535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQ
GEKADSFYIIESGEVSILIRSRLWMYKHSRGFWGPAWTS
Download sequence
Identical sequences H7C4A9
ENSP00000416438 ENSP00000416438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]