SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000417250 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417250
Domain Number 1 Region: 146-253
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000127
Family cAMP-binding domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417250   Gene: ENSG00000121577   Transcript: ENST00000493094
Sequence length 368
Comment pep:putative chromosome:GRCh37:3:119361182:119379730:-1 gene:ENSG00000121577 transcript:ENST00000493094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSANSSRVGQLLLQGSACIRWKQDVEGAVYHLANCLLLLGFMGGSGVYGCFYLFGFLSAG
YLCCVLWGWFSACGLDIVLWSFLLAVVCLLQLAHLVYRLREDTLPEEFDLLYKTLCLPLQ
VPLQTYKEIVHCCEEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY
QFMDSPEWESLQPSEEGVFQVTLTAETSCSYISWPRKSLHLLLTKERYISCLFSALLGYD
ISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLGPTAADAGPESEKGDEEVCEPAVSPPQAT
PTSLQQTPPCSTPPATTNFPAPPTRARLSRPDSGILGEDSTSLVLEDFEEVSGSESFMDY
RSDGEYMR
Download sequence
Identical sequences C9J3P7
ENSP00000340753 ENSP00000340753 ENSP00000417250 XP_005247755.1.92137 ENSP00000340753 ENSP00000417250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]