SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000418510 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418510
Domain Number 1 Region: 1136-1248
Classification Level Classification E-value
Superfamily E set domains 1.47e-35
Family Filamin repeat (rod domain) 0.00000262
Further Details:      
 
Domain Number 2 Region: 1229-1346
Classification Level Classification E-value
Superfamily E set domains 2.34e-35
Family Filamin repeat (rod domain) 0.00000412
Further Details:      
 
Domain Number 3 Region: 1047-1158
Classification Level Classification E-value
Superfamily E set domains 1.33e-31
Family Filamin repeat (rod domain) 0.000000834
Further Details:      
 
Domain Number 4 Region: 1423-1538
Classification Level Classification E-value
Superfamily E set domains 2.07e-31
Family Filamin repeat (rod domain) 0.0000048
Further Details:      
 
Domain Number 5 Region: 869-958
Classification Level Classification E-value
Superfamily E set domains 1.33e-30
Family Filamin repeat (rod domain) 0.00000333
Further Details:      
 
Domain Number 6 Region: 261-378
Classification Level Classification E-value
Superfamily E set domains 1e-29
Family Filamin repeat (rod domain) 0.00065
Further Details:      
 
Domain Number 7 Region: 1336-1442
Classification Level Classification E-value
Superfamily E set domains 1.13e-29
Family Filamin repeat (rod domain) 0.0000234
Further Details:      
 
Domain Number 8 Region: 1623-1719
Classification Level Classification E-value
Superfamily E set domains 1.6e-28
Family Filamin repeat (rod domain) 0.0000128
Further Details:      
 
Domain Number 9 Region: 654-774
Classification Level Classification E-value
Superfamily E set domains 2.13e-28
Family Filamin repeat (rod domain) 0.00044
Further Details:      
 
Domain Number 10 Region: 1995-2091
Classification Level Classification E-value
Superfamily E set domains 4.87e-27
Family Filamin repeat (rod domain) 0.00000992
Further Details:      
 
Domain Number 11 Region: 474-582
Classification Level Classification E-value
Superfamily E set domains 5.47e-27
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 12 Region: 961-1070
Classification Level Classification E-value
Superfamily E set domains 1.47e-26
Family Filamin repeat (rod domain) 0.00000305
Further Details:      
 
Domain Number 13 Region: 1805-1900
Classification Level Classification E-value
Superfamily E set domains 1.53e-26
Family Filamin repeat (rod domain) 0.00000323
Further Details:      
 
Domain Number 14 Region: 83-180
Classification Level Classification E-value
Superfamily E set domains 3.34e-25
Family Filamin repeat (rod domain) 0.00086
Further Details:      
 
Domain Number 15 Region: 183-281
Classification Level Classification E-value
Superfamily E set domains 4e-25
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 16 Region: 2318-2408
Classification Level Classification E-value
Superfamily E set domains 6.27e-25
Family Filamin repeat (rod domain) 0.0000165
Further Details:      
 
Domain Number 17 Region: 2189-2280
Classification Level Classification E-value
Superfamily E set domains 1.8e-24
Family Filamin repeat (rod domain) 0.0000148
Further Details:      
 
Domain Number 18 Region: 572-673
Classification Level Classification E-value
Superfamily E set domains 2.73e-24
Family Filamin repeat (rod domain) 0.00063
Further Details:      
 
Domain Number 19 Region: 2096-2187
Classification Level Classification E-value
Superfamily E set domains 5.14e-24
Family Filamin repeat (rod domain) 0.0000166
Further Details:      
 
Domain Number 20 Region: 368-470
Classification Level Classification E-value
Superfamily E set domains 5.6e-24
Family Filamin repeat (rod domain) 0.0002
Further Details:      
 
Domain Number 21 Region: 782-882
Classification Level Classification E-value
Superfamily E set domains 1.16e-21
Family Filamin repeat (rod domain) 0.00099
Further Details:      
 
Domain Number 22 Region: 1917-2012
Classification Level Classification E-value
Superfamily E set domains 6.14e-21
Family Filamin repeat (rod domain) 0.00001
Further Details:      
 
Domain Number 23 Region: 1714-1803
Classification Level Classification E-value
Superfamily E set domains 2.94e-18
Family Filamin repeat (rod domain) 0.00000491
Further Details:      
 
Domain Number 24 Region: 1562-1638
Classification Level Classification E-value
Superfamily E set domains 3.6e-16
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 
Domain Number 25 Region: 16-74
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000627
Family Calponin-homology domain, CH-domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418510   Gene: ENSG00000136068   Transcript: ENST00000493452
Sequence length 2409
Comment pep:novel chromosome:GRCh37:3:58064056:58156504:1 gene:ENSG00000136068 transcript:ENST00000493452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEHSTRRRSLSLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHS
VMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDV
MVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDK
AQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDK
GNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRI
RETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITW
GGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGP
SQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVR
AYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYT
PVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDC
TEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQE
IPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLP
GDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKL
NGLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPR
EEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAG
TGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEM
PFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGT
YAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATT
DFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYD
DVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPS
ESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGP
GLGSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEG
PYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGE
GLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRAT
QTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENED
GTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMVTEEAYVPVSDMNGLGFKPFDLVIPF
AVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQ
FYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKD
GTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISET
DLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIM
VVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLE
DGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGS
ICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRG
QHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGP
SKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVM
SLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENG
VHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAG
PGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTG
QRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSF
LVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIP
GSPFHVTVP
Download sequence
Identical sequences E7EN95
ENSP00000418510 ENSP00000418510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]