SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000418742 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418742
Domain Number 1 Region: 55-167
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 4.88e-28
Family Inosine monophosphate dehydrogenase (IMPDH) 0.00000346
Further Details:      
 
Domain Number 2 Region: 151-216
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000511
Family CBS-domain pair 0.0000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418742   Gene: ENSG00000106348   Transcript: ENST00000484496
Sequence length 226
Comment pep:known chromosome:GRCh37:7:128032331:128049540:-1 gene:ENSG00000106348 transcript:ENST00000484496 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
SPRLDLATHPTTPRSELSSVVLLAGVGVQMDRLRRASMADYLISGGTGYVPEDGLTAQQL
FASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMA
LMGGIGFIHHNCTPEFQANEVRKVKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPI
TETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEANVPGPTGDDAKD
Download sequence
Identical sequences A0A2J8QWX0 H7C511
ENSP00000418742 ENSP00000418742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]