SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000419577 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419577
Domain Number 1 Region: 134-292
Classification Level Classification E-value
Superfamily CBS-domain pair 1.21e-41
Family CBS-domain pair 0.000000158
Further Details:      
 
Domain Number 2 Region: 297-433
Classification Level Classification E-value
Superfamily CBS-domain pair 2.53e-31
Family CBS-domain pair 0.00000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419577   Gene: ENSG00000106617   Transcript: ENST00000492843
Sequence length 445
Comment pep:putative chromosome:GRCh37:7:151253247:151433400:-1 gene:ENSG00000106617 transcript:ENST00000492843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRFGSLRSNKKHKDQNRSTERRQSEPHGLFASGLSSSPSTPTQVTKQHTFPLESYKHEP
ERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEAGMLE
KLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAA
PLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNI
SPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQN
LDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAE
KTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGI
ISLSDILQALILTPAGAKQKETETE
Download sequence
Identical sequences A0A2J8JZH4 A0A2J8RKH2 E9PGP6
XP_016867762.1.92137 ENSP00000419577 ENSP00000419577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]