SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000419582 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419582
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.76e-27
Family G proteins 0.00000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419582   Gene: ENSG00000158186   Transcript: ENST00000464896
Sequence length 132
Comment pep:putative chromosome:GRCh37:3:138067692:138122028:1 gene:ENSG00000158186 transcript:ENST00000464896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFPMILVANKVDLMHLRKI
TREQGKEMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIPEKSQKKKKKTKWRGDR
ATGTHKLQCVIL
Download sequence
Identical sequences A0A2I2ZDP5 A0A2J8QJA6 A0A2J8TTN8 A0A2K5NXP4 A0A2K6P0V5 F7I8Z8 I7GKQ9
ENSCJAP00000044623 ENSCJAP00000047047 ENSP00000419582 ENSP00000419582 ENSP00000481637 ENSP00000484586 NP_001239020.1.87134 NP_001239020.1.92137 NP_001239021.1.87134 NP_001239021.1.92137 NP_001239022.1.87134 NP_001239022.1.92137 XP_006936437.1.62641 XP_006936438.1.62641 XP_007087491.1.5354 XP_007087492.1.5354 XP_011383335.1.92234 XP_011813530.1.43180 XP_011837226.1.47321 XP_014929644.1.86478 XP_019293190.1.44245 XP_019293200.1.44245 XP_021534425.1.83697 XP_021534426.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]