SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000419609 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419609
Domain Number 1 Region: 50-137,221-288
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 6.78e-37
Family Inosine monophosphate dehydrogenase (IMPDH) 0.00000218
Further Details:      
 
Domain Number 2 Region: 131-245
Classification Level Classification E-value
Superfamily CBS-domain pair 2.04e-25
Family CBS-domain pair 0.000000616
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419609   Gene: ENSG00000106348   Transcript: ENST00000497868
Sequence length 289
Comment pep:novel chromosome:GRCh37:7:128038468:128050040:-1 gene:ENSG00000106348 transcript:ENST00000497868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPLTPPPLQGGGAAAVPEPGARQHPGHETAAQRYSARLLQAGYEPESDFLILPGFIDF
IADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEV
RKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDID
FLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIAR
TDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVL
Download sequence
Identical sequences C9K0R9
ENSP00000419609 ENSP00000419609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]