SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000419638 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419638
Domain Number 1 Region: 143-557
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.84e-88
Family Amylase, catalytic domain 0.0000871
Further Details:      
 
Domain Number 2 Region: 559-656
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.61e-26
Family alpha-Amylases, C-terminal beta-sheet domain 0.0069
Further Details:      
 
Domain Number 3 Region: 28-140
Classification Level Classification E-value
Superfamily E set domains 1.61e-19
Family E-set domains of sugar-utilizing enzymes 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419638   Gene: ENSG00000114480   Transcript: ENST00000489715
Sequence length 661
Comment pep:novel chromosome:GRCh37:3:81539084:81792780:-1 gene:ENSG00000114480 transcript:ENST00000489715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLAKVRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLT
GDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWA
KYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTC
NVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGTPEELQELVDTAHSMGI
IVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEILRFLLSN
IRWWLEEYRFDGFRFDGVTSMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVH
TLCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIV
YTLTNRRYLEKCIAYAESHDQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHK
MIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLN
NFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTA
LPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLP
N
Download sequence
Identical sequences E9PGM4
ENSP00000419638 ENSP00000419638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]