SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000419954 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000419954
Domain Number - Region: 1-19
Classification Level Classification E-value
Superfamily E set domains 0.00981
Family Filamin repeat (rod domain) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419954   Gene: ENSG00000136068   Transcript: ENST00000470231
Sequence length 72
Comment pep:known chromosome:GRCh37:3:58135708:58139124:1 gene:ENSG00000136068 transcript:ENST00000470231 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
FADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPGVRVMNCSAQIL
WGWRVQFHTGSR
Download sequence
Identical sequences A0A0C4DGA1 A0A2J8P7Q3 A0A2J8T1B5
ENSP00000419954 HR2710 ENSP00000419954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]