SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420044 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420044
Domain Number 1 Region: 22-66
Classification Level Classification E-value
Superfamily PH domain-like 0.0000261
Family Pleckstrin-homology domain (PH domain) 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420044   Gene: ENSG00000163618   Transcript: ENST00000478434
Sequence length 178
Comment pep:putative chromosome:GRCh37:3:62518594:62536564:-1 gene:ENSG00000163618 transcript:ENST00000478434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRKHLEEKGVQMLLIGLEGGRAFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKP
VPPTQVQKLNAKGGNVPQLDAPISQFYADRAQKHGMDEFISSNPCNFDHASLFEMVQRLT
LDHRLNDSYSCLGWFSPGQVFVLDEYCARNGVRGCHRHLCYLRDLLERAENGAMIDPT
Download sequence
Identical sequences ENSP00000420044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]