SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000420199 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420199
Domain Number 1 Region: 49-128
Classification Level Classification E-value
Superfamily E set domains 3.56e-22
Family Filamin repeat (rod domain) 0.0000335
Further Details:      
 
Domain Number 2 Region: 3-46
Classification Level Classification E-value
Superfamily E set domains 0.000000000042
Family Filamin repeat (rod domain) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420199   Gene: ENSG00000136068   Transcript: ENST00000466455
Sequence length 135
Comment pep:known chromosome:GRCh37:3:58135593:58139368:1 gene:ENSG00000136068 transcript:ENST00000466455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPEINSSDMSAHVTSP
SGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKV
RAGGPGLERGEAGVP
Download sequence
Identical sequences H7C5L4
ENSP00000420199 ENSP00000420199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]