SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000420645 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420645
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily CBS-domain pair 7.58e-22
Family CBS-domain pair 0.00000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420645   Gene: ENSG00000106617   Transcript: ENST00000478989
Sequence length 118
Comment pep:known chromosome:GRCh37:7:151261281:151272037:-1 gene:ENSG00000106617 transcript:ENST00000478989 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNISPDASLFDAVYS
LIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFVHQEDGINYTLYKRCLICQSLPS
Download sequence
Identical sequences A0A1D5RCW5 A0A2J8JZF2 A0A2J8RKN3 F8WDB5
ENSP00000420645 ENSP00000420645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]